PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G30140.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 423aa    MW: 44904.8 Da    PI: 7.4189
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G30140.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA565.3e-18340373134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  LPERR02G30140.2 340 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 373
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.6E-15334384IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.76E-14334396No hitNo description
PROSITE profilePS5011411.082334370IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-14338371IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.66E-14339396No hitNo description
PfamPF003201.2E-15340373IPR000679Zinc finger, GATA-type
PROSITE patternPS003440340365IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MAGVGFVEEM LREQSLLEAT CGDLFDHIDD LLDFPKEESA ADVLLLDAPA PGSPLSSRII  60
GGVAPPPPPA TATTGQMVTA ALRRCSTPPA RSRARTPTLA RLPYPTTIPK PNKRACDELD  120
MDMAQLEWLS ELFDDGTIPH EPSFPAGVNC TAPIKSSAMA ASTANVVLPD KMVEEALFRS  180
SSPISVLEQH IANGGSSSSS SSSASSSSES FAWSAPVSPR PEPPVLIIPA RARSKRSRPS  240
AFPAAVRSSA AAAAENEMTI LVPTPMYSST SSQSDPESIA ESSPHTQTQP PMKKKKKAKK  300
PALPAASDGE GDADADYEEE AAAGGGGGAR ALPPGTVRRC THCQIEKTPQ WRAGPLGPKT  360
LCNACGVRYK SGRLFPEYRP AASPTFVPSI HSNSHKKVVE MRQKVTRNAD PSCDLLQYIR  420
RRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0691581e-80AC069158.6 Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0049O12, from chromosome 2, complete sequence.
GenBankAP0041531e-80AP004153.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1111_C07.
GenBankAP0149581e-80AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-80CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankCT8289651e-80CT828965.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA219J10, full insert sequence.
GenBankCT8289661e-80CT828966.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA222D18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954283.11e-169PREDICTED: GATA transcription factor 8-like
RefseqXP_004954284.11e-169PREDICTED: GATA transcription factor 8-like
TrEMBLA0A0D9VMD90.0A0A0D9VMD9_9ORYZ; Uncharacterized protein
STRINGSi017314m1e-169(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.27e-37GATA family protein